TRPV5 antibody Western blot. All lanes: Anti TRPV5 at 0.5 ug/ml. Lane 1: Rat Pancreas Tissue Lysate at 50 ug. Lane 2: Rat Lung Tissue Lysate at 50 ug. Lane 3: Rat Intestine Tissue Lysate at 50 ug. Lane 4: SW620 Whole Cell Lysate at 40 ug. Lane 5: COLO320 Whole Cell Lysate at 40 ug. Lane 6: 293T Whole Cell Lysate at 40 ug. Predicted band size: 83 kD. Observed band size: 83 kD.
ECaC / TRPV5 Antibody (aa580-610)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407731-100
Catalog Number: LS-C407731
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TRPV5 antibody LS-C407731 is an unconjugated rabbit polyclonal antibody to TRPV5 (ECaC) (aa580-610) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CAT2 | Calcium transport protein 2 | Calcium transporter 2 | ECAC1 | Epithelial calcium channel 1 | ECaC | OTRPC3 | TRPV5 | Osm-9-like TRP channel 3
- UniProt Number
- Q9NQA5
- NCBI GenBank
- NM_019841 | NP_062815.3
- SwissProt
- Q9NQA5
Target
- Target
- Human ECaC / TRPV5
- Antigen Species
- Human
- Epitope
- Expressed at high levels in kidney, small intestine and pancreas, and at lower levels in testis, prostate, placenta, brain, colon and rectum. .
- Gene Name
- TRPV5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human TRPV5 (580-610 aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl