Western blot analysis of FABP5 using anti-FABP5 antibody
E-FABP / FABP5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662946-100
Catalog Number: LS-C662946
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- FABP5 antibody LS-C662946 is an unconjugated rabbit polyclonal antibody to human FABP5 (E-FABP). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FABP5 | KFABP | Fatty acid-binding protein 5 | PA-FABP | E-FABP | EFABP | PAFABP
- UniProt Number
- Q01469
- NCBI GenBank
- NM_001444 | NP_001435.1
- SwissProt
- Q01469
Target
- Target
- Human E-FABP / FABP5
- Antigen Species
- Human
- Epitope
- Keratinocytes; highly expressed in psoriatic skin.
- Gene Name
- FABP5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human FABP5 (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl