Western blot testing of 1) rat brain and 2) mouse brain lysate with DVL3 antibody at 0.5ug/ml. Predicted molecular weight ~78 kDa.
DVL3 / Dishevelled 3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782814-100
Catalog Number: LS-C782814
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Dishevelled 3 antibody LS-C782814 is an unconjugated rabbit polyclonal antibody to Dishevelled 3 (DVL3) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DSH homolog 3 | DVL3 | Dishevelled-3 | KIAA0208
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- Q92997
- NCBI GenBank
- NM_004423, NP_004414.3
- SwissProt
- Q92997
Target
- Target
- Mouse DVL3 / Dishevelled 3
- Antigen Species
- Ms
- Gene Name
- DVL3
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Hu
Immunogen
- Immunogen
- Amino acids 397-434 (DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWL) from the human protein were used as the immunogen for the DVL3 antibody.
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS