Western blot testing of 1) rat liver and 2) mouse kidney lysate with Dishevelled 2 antibody at 0.5ug/ml. Predicted molecular weight ~79 kDa, can be observed at 90-95 kDa.
DVL2 / Dishevelled 2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781929-100
Catalog Number: LS-C781929
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Dishevelled 2 antibody LS-C781929 is an unconjugated rabbit polyclonal antibody to Dishevelled 2 (DVL2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DSH homolog 2 | DVL2 | Dishevelled-2 | Dishevelled 2
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- O14641
- NCBI GenBank
- NM_004422 | NP_004413.1
- SwissProt
- O14641
Target
- Target
- Human DVL2 / Dishevelled 2
- Antigen Species
- Human
- Gene Name
- DVL2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 35-64 (AERITLGDFKSVLQRPAGAKYFFKSMDQDF) from the human protein were used as the immunogen for the Dishevelled 2 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS