Western blot - Anti-Dishevelled 2 Picoband Antibody
DVL2 / Dishevelled 2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662151-100
Catalog Number: LS-C662151
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Dishevelled 2 antibody LS-C662151 is an unconjugated rabbit polyclonal antibody to human Dishevelled 2 (DVL2). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DSH homolog 2 | DVL2 | Dishevelled-2 | Dishevelled 2
- UniProt Number
- O14641
- NCBI GenBank
- NM_004422 | NP_004413.1
- SwissProt
- O14641
Target
- Target
- Human DVL2 / Dishevelled 2
- Antigen Species
- Human
- Gene Name
- DVL2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Dishevelled 2 (35-64 aa AERITLGDFKSVLQRPAGAKYFFKSMDQDF), identical to the related mouse sequence.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl