Western blot analysis of extracts of Raji cells, using DUSP5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

DUSP5 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C496919-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: DUSP5 antibody LS-C496919 is an unconjugated rabbit polyclonal antibody to human DUSP5. Validated for WB.
Application: IHC, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Dual specificity phosphatase 5 | DUSP5 | HVH3 | Phosphatase vh3 | VH1-like phosphatase 3 | VH3 | DUSP
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q16690
NCBI GenBank: NM_004419 | NP_004410.3
SwissProt: Q16690

Target

Target: Human DUSP5
Antigen Species: Human
Gene Name: DUSP5

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 315-384 of human DUSP5 (NP_004410.3). SEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)