Western blot analysis of extracts of Mouse brain, using DLG4 antibody.
DLG4 / PSD95 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunoprecipitation, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C334550-20
Catalog Number: LS-C334550
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PSD95 antibody LS-C334550 is an unconjugated rabbit polyclonal antibody to PSD95 (DLG4) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB.
- Application
- IHC, IP, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Disks large homolog 4 | Presynaptic density protein 95 | PSD95 | SAP-90 | Synapse-associated protein 90 | PSD-95 | SAP90 | Tax interaction protein 15 | Discs large homolog 4 | DLG4
- Recommended Dilution: IHC
- 1:50 - 1:100
- Recommended Dilution: IP
- 1:20 - 1:50
- Recommended Dilution: WB
- 1:500 - 1:1000
- UniProt Number
- P78352
- NCBI GenBank
- NM_001365 | NP_001356.1
- SwissProt
- P78352
Target
- Target
- Human DLG4 / PSD95
- Antigen Species
- Human
- Epitope
- Human DLG4 / PSD95
- Gene Name
- DLG4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DLG4 (NP_001356.1). MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGT
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS