DGAT1 antibody Western blot. All lanes: Anti DGAT1 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: HELA Whole Cell Lysate at 40 ug. Predicted band size: 60 kD. Observed band size: 60 kD.

DGAT1 Antibody (aa280-318)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Rat
Format:	Lyophilized

$480.00each

Catalog Number: LS-C408013-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: DGAT1 antibody LS-C408013 is an unconjugated rabbit polyclonal antibody to DGAT1 (aa280-318) from human. It is reactive with human and rat. Validated for WB.
Application: WB
Reactivity: Hu, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ACAT-related gene product 1 | ACAT related gene product 1 | ARGP1 | ARAT | DGAT | Diglyceride acyltransferase | AGRP1 | DGAT1
UniProt Number: O75907
NCBI GenBank: NM_012079 | NP_036211.2
SwissProt: O75907

Target

Target: Human DGAT1
Antigen Species: Human
Gene Name: DGAT1

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280-318 aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR), different from the related mouse and rat sequences by one amino acid.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl