Western blot analysis of extracts of various cells.
DERL1 / Derlin 1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C410043-20
Catalog Number: LS-C410043
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Derlin 1 antibody LS-C410043 is an unconjugated rabbit polyclonal antibody to Derlin 1 (DERL1) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DER1 | Der1-like protein 1 | DERL1 | Derlin-1 | DERtrin-1 | PRO2577 | DER-1 | Derlin 1
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9BUN8
- NCBI GenBank
- NM_024295 | NP_077271.1
- SwissProt
- Q9BUN8
Target
- Target
- Human DERL1 / Derlin 1
- Antigen Species
- Human
- Epitope
- Human DERL1 / DERLIN 1
- Gene Name
- DERL1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 182-251 of human DERL1 (NP_077271.1). LYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS