Delta-6 Desaturase / FADS2 Antibody
Catalog Number: LS-C668519
4 sizes / from $272.00
Antibody: Rabbit Polyclonal
Applications: Western Blot
Reactivity: Human
Format: Liquid
Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
Delta-6 Desaturase / FADS2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin |
| Reactivity: | Human |
| Format: | Liquid |
$383.00each
Catalog Number: LS-B13249-50
Catalog Number: LS-B13249
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- FADS2 antibody LS-B13249 is an unconjugated rabbit polyclonal antibody to human FADS2 (Delta-6 Desaturase). Validated for IHC.
- Application
- IHC, IHC-P
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- D6D | Delta-6 fatty acid desaturase | Delta-6-desaturase | FADSD6 | LLCDL2 | SLL0262 | TU13 | Delta(6) desaturase | Delta(6) fatty acid desaturase | Delta-6 desaturase | DES6 | FADS2 | Fatty acid desaturase 2
- Recommended Dilution: IHC-P
- 10 µg/ml
- UniProt Number
- O95864
- NCBI GenBank
- NM_004265, NP_004256.1
- SwissProt
- O95864
Target
- Target
- Delta-6 Desaturase / FADS2
- Antigen Species
- Hu
- Gene Name
- FADS2
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Origin Species
- Hu
Immunogen
- Immunogen
- Synthetic peptide directed towards the following sequence ATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVIGHLKGASANWWNHRHF
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, 0.09% sodium azide, 2% sucrose
- Concentration
- 0.5 mg/mL
- Volume
- 50 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles.
- Recommended Storage Buffer
- PBS
