DEFB4A / BD-2 Antibody (aa4-41)
Primary AntibodyLSBio Guarantee
| Antibody: | Sheep Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay |
| Reactivity: | Human |
| Format: | Lyophilized |
$470.00each
Catalog Number: LS-C127019-20
Catalog Number: LS-C127019
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- BD-2 antibody LS-C127019 is an unconjugated sheep polyclonal antibody to human BD-2 (DEFB4A) (aa4-41). Validated for ELISA.
- Application
- ELISA
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Beta-defensin 2 | Beta-defensin 4A | DEFB-2 | DEFB102 | Defensin, beta 2 | Defensin, beta 4 | Defensin, beta 4A | DEFB4 | DEFB4A | DEFB2 | HBD-2 | Skin-antimicrobial peptide 1 | BD-2 | SAP1
- Recommended Dilution: ELISA
- 1:5000
- NCBI GenBank
- NM_004942|NP_004933.1
Target
- Target
- Human DEFB4A / BD-2
- Antigen Species
- Human
- Epitope
- Recognizes human beta-Defensin 2 (epitope: aa 4-41).
Antibody
- Host Species
- Sheep
- Clonality
- Polyclonal
Immunogen
- Immunogen
- Synthetic human -Defensin 2 (aa 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Gibbon, Monkey (97%); Orangutan (81%).
- Immunogen Type
- Synthetic Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, pH 7.2
- Volume
- 20 Microliter
- Preservative
- No
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at -20°C. Aliquot and store at -20°C. Reconstituted product is stable for 1 year at -20°C.
- Recommended Storage Buffer
- PBS