DEFB1 / BD-1 Antibody (aa1-36, clone M4-14B-H4)
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$491.00each
Catalog Number: LS-C127008-10
Catalog Number: LS-C127008
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- BD-1 antibody LS-C127008 is an unconjugated mouse monoclonal antibody to human BD-1 (DEFB1) (aa1-36). Validated for ELISA and WB.
- Application
- ELISA, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- BD1 | Beta-defensin 1 | BD-1 | Beta Defensin 1 | DEFB-1 | DEFB101 | Defensin, beta 1 | Defensin beta | DEFB1 | HBD-1 | Beta-defensin-1 | HBD1
- Recommended Dilution: WB
- 1:1000 - 1:2000
- UniProt Number
- P60022
- NCBI GenBank
- NM_005218|NP_005209.1
- SwissProt
- P60022
Target
- Target
- Human DEFB1 / BD-1
- Antigen Species
- Human
- Epitope
- Recognizes human beta-Defensin 1 (epitope: aa 1-36).
- Gene Name
- DEFB1
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Clone
- M4-14B-H4
- Isotype
- IgG1
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic human -Defensin 1 (aa 1-36) (3 disulfide bridges) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK). Percent identity by BLAST analysis: Human, Orangutan (100%); Chimpanzee, Gorilla (97%); Gibbon, Monkey (90%); Baboon (87%); Tamarin (84%); Marmoset (81%).
- Immunogen Type
- Synthetic Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 50 mM Tris, pH 7.4
- Preservative
- No
- Purification Method
- Protein G Affinity
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at -20°C. Aliquot and store at -20°C. Reconstituted product is stable for 1 year at -20°C.
- Recommended Storage Buffer
- 50 mm tris