Western blot analysis of extracts of various cells.
DEFA3 / Defensin Alpha 3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408827-20
Catalog Number: LS-C408827
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Defensin Alpha 3 antibody LS-C408827 is an unconjugated rabbit polyclonal antibody to human Defensin Alpha 3 (DEFA3). Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DEF3 | DEFA3 | HNP-3 | HP-3 | HNP3 | Neutrophil defensin 3 | HP3 | Neutrophil peptide 3 | Defensin, alpha 3
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P59666
- NCBI GenBank
- NM_005217 | NP_005208.1
- SwissProt
- P59666
Target
- Target
- Human DEFA3 / Defensin Alpha 3
- Antigen Species
- Human
- Epitope
- Human DEFA3 / Defensin Alpha 3
- Gene Name
- DEFA3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 20-94 of human DEFA3 (NP_005208.1). EPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS