
Western blot testing of 1) rat testis and 2) human HeLa lysate with Alpha Defensin 1 antibody at 0.5ug/ml. Predicted molecular weight ~19 kDa.
DEFA1 / Defensin Alpha 1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C783003-100
Catalog Number: LS-C783003
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Defensin Alpha 1 antibody LS-C783003 is an unconjugated rabbit polyclonal antibody to Defensin Alpha 1 (DEFA1) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DEFA1 | DEFA2 | Defensin, alpha 2 | HP-1 | HP1 | Myeloid-related sequence | MRS | DEF1 | Defensin, alpha 1 | HNP-1 | Neutrophil defensin 1
- UniProt Number
- P59665
- NCBI GenBank
- NM_004084 | NP_004075.1
- SwissProt
- P59665
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human DEFA1 / Defensin Alpha 1
- Antigen Species
- Human
- Gene Name
- DEFA1|DEFA1B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 65-94 (ACYCRIPACIAGERRYGTCIYQGRLWAFCC) from the human protein were used as the immunogen for the Alpha Defensin 1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
