
IHC staining of FFPE human ovarian cancer with DDT antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
DDT / Dopamine Tautomerase Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782208-100
Catalog Number: LS-C782208
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Dopamine Tautomerase antibody LS-C782208 is an unconjugated rabbit polyclonal antibody to Dopamine Tautomerase (DDT) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- D-dopachrome decarboxylase | D-dopachrome tautomerase | DDCT | DDT | Phenylpyruvate tautomerase II
- UniProt Number
- P30046
- NCBI GenBank
- NM_001355 | NP_001346.1
- SwissProt
- P30046
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 2 - 3 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human DDT / Dopamine Tautomerase
- Antigen Species
- Human
- Gene Name
- DDT
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL were used as the immunogen for the DDT antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- 1X PBS
