Western blot analysis of extracts of various cell lines.
DBI / ACBD1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C334019-20
Catalog Number: LS-C334019
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ACBD1 antibody LS-C334019 is an unconjugated rabbit polyclonal antibody to human ACBD1 (DBI). Validated for IF, IHC and WB.
- Application
- IF, IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ACBP | Acyl-CoA-binding protein | CCK-RP | DBI | ACBD1 | GABA receptor modulator | EP | Endozepine
- Recommended Dilution: IF/ICC
- 1:50 - 1:200
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P07108
- NCBI GenBank
- NM_020548 | NP_065438.1
- SwissProt
- P07108
Target
- Target
- Human DBI / ACBD1
- Antigen Species
- Human
- Epitope
- Human EP / DBI
- Gene Name
- DBI
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human DBI (NP_001171513.1). MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS