DAPK2 / DAP Kinase 2 Antibody (AP)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409734-20
Catalog Number: LS-C409734
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- DAP Kinase 2 antibody LS-C409734 is an AP-conjugated rabbit polyclonal antibody to DAP Kinase 2 (DAPK2) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- DAP-kinase-related protein 1 | DAPK2 | DRP-1 | DRP1 | DAP kinase 2
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9UIK4
- NCBI GenBank
- NM_014326 | NP_055141.2
- SwissProt
- Q9UIK4
Target
- Target
- Human DAPK2 / DAP Kinase 2
- Antigen Species
- Human
- Epitope
- Human DAPK2 / DAP Kinase 2
- Gene Name
- DAPK2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human DAPK2 (NP_055141.2). VVNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESDTEEDIARRKALHPRRRSSTS
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Alkaline Phosphatase
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS