Flow Cytometry analysis of A549 cells using anti-Human POR antibody. Overlay histogram showing A549 cells stained with anti-Human POR antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Human POR Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CYPOR / POR Antibody (DY488)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry |
| Reactivity: | Human |
| Format: | Liquid |
$583.00each
Catalog Number: LS-C756535-190
Catalog Number: LS-C756535
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- POR antibody LS-C756535 is a DY488-conjugated rabbit polyclonal antibody to human POR (CYPOR). Validated for Flow.
- Application
- FC
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CPR | CYPOR | POR | p450R
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- UniProt Number
- P16435
- NCBI GenBank
- AB051763 | BAB18572.1
- SwissProt
- P16435
Target
- Target
- Human CYPOR / POR
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- POR
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human POR(633-668 aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- DyLight 488
- Format
- Liquid
- Formulation
- 0.2% Na2HPO40.9% NaCl, 0.02% sodium azide, 50% glycerol
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. Do not freeze. Protect from light.
- Recommended Storage Buffer
- NaCl