
IHC testing of FFPE human liver cancer tissue with CYP3A4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
CYP3A4 / Cytochrome P450 3A4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781854-100
Catalog Number: LS-C781854
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Cytochrome P450 3A4 antibody LS-C781854 is an unconjugated rabbit polyclonal antibody to human Cytochrome P450 3A4 (CYP3A4). Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Cyp3a3 | CYP3A4 | CYPIIIA3 | CYPIIIA4 | Cytochrome P450 3A3 | Cytochrome P450 3A4 | CP33 | CP34 | CYP3A | Cytochrome P450 NF-25 | HLP | NF-25 | p450C3 | Cytochrome P450 HLp | Cytochrome P450-PCN1 | Glucocorticoid-inducible P450 | p450-III, steroid inducible | p450PCN1
- UniProt Number
- P08684
- SwissProt
- P08684
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human CYP3A4 / Cytochrome P450 3A4
- Antigen Species
- Human
- Gene Name
- CYP3A4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 237-277 (NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID) from the human protein were used as the immunogen for the CYP3A4 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
