CYP3A4 was detected in paraffin-embedded sections of human liver cancer tissues using rabbit anti- CYP3A4 Antigen Affinity purified polyclonal antibody
CYP3A4 / Cytochrome P450 3A4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662339-100
Catalog Number: LS-C662339
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Cytochrome P450 3A4 antibody LS-C662339 is an unconjugated rabbit polyclonal antibody to human Cytochrome P450 3A4 (CYP3A4). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Cyp3a3 | CYP3A4 | CYPIIIA3 | CYPIIIA4 | Cytochrome P450 3A3 | Cytochrome P450 3A4 | CP33 | CP34 | CYP3A | Cytochrome P450 NF-25 | HLP | NF-25 | p450C3 | Cytochrome P450 HLp | Cytochrome P450-PCN1 | Glucocorticoid-inducible P450 | p450-III, steroid inducible | p450PCN1
- UniProt Number
- P08684
- SwissProt
- P08684
Target
- Target
- Human CYP3A4 / Cytochrome P450 3A4
- Antigen Species
- Human
- Epitope
- Expressed in prostate and liver. According to some authors, it is not expressed in brain (PubMed:19094056). According to others, weak levels of expression are measured in some brain locations (PubMed:19359404 and PubMed:18545703). Also expressed in epithelium of the small intestine and large intestine, bile duct, nasal mucosa, kidney, adrenal cortex, epithelium of the gastric mucosa with intestinal metaplasia, gallbladder, intercalated ducts of the pancreas, chief cells of the parathyroid and the corpus luteum of the ovary (at protein level). .
- Gene Name
- CYP3A4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human CYP3A4 (237-277 aa NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl