Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
CYP27B1 antibody Western blot. All lanes: Anti CYP27B1 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Mouse Kidney Tissue Lysate at 50 ug. Lane 3: 293T Whole Cell Lysate at 40 ug. Predicted band size: 57 kD. Observed band size: 57 kD.
CYP27B1 Antibody (aa475-508)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407761-100
Catalog Number: LS-C407761
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CYP27B1 antibody LS-C407761 is an unconjugated rabbit polyclonal antibody to CYP27B1 (aa475-508) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Cited in 1 publication.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 1alpha(OH)ase | 25-OHD-1 alpha-hydroxylase | Calcidiol 1-monooxygenase | CYP1alpha | CYP27B | Cytochrome P450C1 alpha | Cytochrome p450 27B1 | Cytochrome P450VD1-alpha | p450c1 | VD3 1A hydroxylase | PDDR | VDD1 | CP2B | CYP1 | CYP27B1 | VDDR | VDDRI
- UniProt Number
- O15528
- NCBI GenBank
- NM_000785 | NP_000776.1
- SwissProt
- O15528
Target
- Target
- Human CYP27B1
- Antigen Species
- Human
- Epitope
- Kidney.
- Gene Name
- CYP27B1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human CYP27B1 (475-508 aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR), different from the related mouse and rat sequences by six amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Concentration
- 0.5 mg/mL
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
Hemoglobin alters vitamin carrier uptake and vitamin D metabolism in proximal tubule cells: implications for sickle cell disease. Megan L Gliozzi, Youssef Rbaibi, Kimberly R Long, Dario A Vitturi, Ora A Weisz. American journal of physiology. Cell physiology. 2019 November;317:C993-C1000. PubMed: 31509446 PMC: PMC6879883
