Western blot analysis of extracts of various cell lines.
CYB5A / Cytochrome b5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C334039-20
Catalog Number: LS-C334039
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Cytochrome b5 antibody LS-C334039 is an unconjugated rabbit polyclonal antibody to human Cytochrome b5 (CYB5A). Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CYB5 | CYB5A | Cytochrome b5 (microsomal) | MCB5 | Type 1 cyt-b5 | Cytochrome b-5 | Cytochrome b5
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P00167
- NCBI GenBank
- NM_001914 | NP_001905.1
- SwissProt
- P00167
Target
- Target
- Human CYB5A / Cytochrome b5
- Antigen Species
- Human
- Epitope
- Human CYB5A / Cytochrome b5
- Gene Name
- CYB5A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CYB5A (NP_683725.1). MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLI
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS