
CSNK1A1 / CK1 Alpha Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490365-100
Catalog Number: LS-C490365
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CK1 Alpha antibody LS-C490365 is an unconjugated rabbit polyclonal antibody to CK1 Alpha (CSNK1A1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CK1 alpha | CK1a | CK1alpha | Clock regulator kinase | CSNK1A1 | CK1 | Casein kinase 1 alpha | CKIa | CKIalpha | Down-regulated in lung cancer | HLCDGP1 | PRO2975 | Casein kinase 1, alpha 1 | Casein kinase I alpha | Casein kinase I isoform alpha | CKI-alpha
- UniProt Number
- P48729
- NCBI GenBank
- NM_001892 | NP_001883.4
- SwissProt
- P48729
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 0.5 - 1 µg/ml |
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human CSNK1A1 / CK1 Alpha
- Antigen Species
- Human
- Gene Name
- CSNK1A1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ of human CSNK1A1 were used as the immunogen for the CSNK1A1 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
