CSNK1A1 antibody Western blot. All lanes: Anti CSNK1A1 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Kidney Tissue Lysate at 50 ug. Lane 3: Mouse Kidney Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 39 kD. Observed band size: 39 kD.
CSNK1A1 / CK1 Alpha Antibody (aa30-68)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Chicken, Dog, Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407905-100
Catalog Number: LS-C407905
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CK1 Alpha antibody LS-C407905 is an unconjugated rabbit polyclonal antibody to CK1 Alpha (CSNK1A1) (aa30-68) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Can, Ck, Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CK1 alpha | CK1a | CK1alpha | Clock regulator kinase | CSNK1A1 | CK1 | Casein kinase 1 alpha | CKIa | CKIalpha | Down-regulated in lung cancer | HLCDGP1 | PRO2975 | Casein kinase 1, alpha 1 | Casein kinase I alpha | Casein kinase I isoform alpha | CKI-alpha
- UniProt Number
- P48729
- NCBI GenBank
- NM_001892 | NP_001883.4
- SwissProt
- P48729
Target
- Target
- Human CSNK1A1 / CK1 Alpha
- Antigen Species
- Human
- Gene Name
- CSNK1A1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human CSNK1A1 (30-68 aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl