Western blot analysis of extracts of NCI-H460 cells, using CRY1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

CRY1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human, Mouse
Format:	Liquid

$293.00each

Catalog Number: LS-C748704-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: CRY1 antibody LS-C748704 is an unconjugated rabbit polyclonal antibody to CRY1 from human. It is reactive with human and mouse. Validated for IHC and WB.
Application: IHC, WB
Reactivity: Hu, Ms
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Chryptochrome 1 | Cryptochrome-1 | Photolyase homolog 1 | CRY1 | PHLL1
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q16526
NCBI GenBank: NM_004075 | NP_004066.1
SwissProt: Q16526

Target

Target: Human CRY1
Antigen Species: Human
Gene Name: CRY1

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 507-586 of human CRY1 (NP_004066.1). PNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)