
Western blot blot of extracts of various cells, using CRHR1 antibody.
CRFR1 / CRHR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409944-20
Catalog Number: LS-C409944
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CRHR1 antibody LS-C409944 is an unconjugated rabbit polyclonal antibody to CRHR1 (CRFR1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CRF-R-1 | CRFR | CRHR1 | CRHR1f | Crf receptor 1 | CRH-R1 | CRF-R | CRF1 | CRFR-1 | Crf receptor type 1 | Crf type 1 | CRF-R1 | Crf1 receptor | CRFR1 | CRH-R-1 | CRH-R1h | CRHR | CRHR1L
- UniProt Number
- P34998
- NCBI GenBank
- NM_004382
- SwissProt
- P34998
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC | 1:50 - 1:200 |
| WB | 1:500 - 1:2000 |
Target
- Target
- Human CRFR1 / CRHR1
- Antigen Species
- Human
- Epitope
- Human CRFR1 / CRHR1
- Gene Name
- CRHR1|LINC02210-CRHR1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 24-120 of human CRHR1 (NP_001138618.1). SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
