Western blot analysis of GADD45G using anti-GADD45G antibody
CR6 / GADD45G Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662958-100
Catalog Number: LS-C662958
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GADD45G antibody LS-C662958 is an unconjugated rabbit polyclonal antibody to human GADD45G (CR6). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CR6 | DDIT2 | GADD45-gamma | GADD45G | GADD45gamma | Gadd-related protein, 17 kD | GRP17 | DDIT-2
- UniProt Number
- O95257
- NCBI GenBank
- NM_006705 | NP_006696.1
- SwissProt
- O95257
Target
- Target
- Human CR6 / GADD45G
- Antigen Species
- Human
- Gene Name
- GADD45G
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human GADD45G (MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQ).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl