Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
CPT1B antibody Western blot. All lanes: Anti CPT1B at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 3: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Lane 4: Mouse Cardiac Muscle Tissue Lysate at 50 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 88 kD. Observed band size: 88 kD.
CPT1B Antibody (aa197-226)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407704-100
Catalog Number: LS-C407704
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CPT1B antibody LS-C407704 is an unconjugated rabbit polyclonal antibody to CPT1B (aa197-226) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CPT1M | CPTI | CPT I | CPT1-M | CPT1B | CPTI-M | KIAA1670 | M-CPT1 | MCCPT1
- UniProt Number
- Q92523
- NCBI GenBank
- NM_004377 | NP_004368.1
- SwissProt
- Q92523
Target
- Target
- Human CPT1B
- Antigen Species
- Human
- Epitope
- Strong expression in heart and skeletal muscle. No expression in liver and kidney.
- Gene Name
- CPT1B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human CPT1B (197-226 aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
