Western blot analysis of extracts of various cell lines, using CPLX3 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

CPLX3 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C748729-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: CPLX3 antibody LS-C748729 is an unconjugated rabbit polyclonal antibody to CPLX3 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Complexin-3 | CPLX3 | CPX-III | Complexin 3 | Complexin III | CPXIII | Nbla11589 | CPX III
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q8WVH0
SwissProt: Q8WVH0

Target

Target: Human CPLX3
Antigen Species: Human
Gene Name: CPLX3

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 59-158 of human CPLX3 (NP_001025176.1). DAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)