
Western blot analysis of extracts of Jurkat cells.
CORO1A / Coronin 1a Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C410834-20
Catalog Number: LS-C410834
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Coronin 1a antibody LS-C410834 is an unconjugated rabbit polyclonal antibody to Coronin 1a (CORO1A) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Clipin-A | Coronin-like protein A | Coronin-like protein p57 | CLIPINA | CORO1A | Coronin-1 | Coronin-1A | HCORO1 | p57 | TACO | CLABP | CORO1
- UniProt Number
- P31146
- NCBI GenBank
- NM_007074 | NP_009005.1
- SwissProt
- P31146
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human CORO1A / Coronin 1a
- Antigen Species
- Human
- Epitope
- Human CORO1A / Coronin 1a
- Gene Name
- CORO1A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 362-461 of human CORO1A (NP_001180262.1). DLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
