
Western blot analysis of extracts of MCF7 cells, using COA3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
COA3 / CCDC56 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C749584-20
Catalog Number: LS-C749584
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CCDC56 antibody LS-C749584 is an unconjugated rabbit polyclonal antibody to human CCDC56 (COA3). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Recommended Dilution: WB
- 1:500 - 1:2000
- NCBI GenBank
- NM_001040431 | NP_001035521.1
Target
- Target
- Human COA3 / CCDC56
- Antigen Species
- Human
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human COA3 (NP_001035521.1). MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
