Western blot analysis of extracts of mouse lung, using CLDN5 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.
CLDN5 / Claudin 5 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C496916-20
Catalog Number: LS-C496916
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Claudin 5 antibody LS-C496916 is an unconjugated rabbit polyclonal antibody to Claudin 5 (CLDN5) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- BEC1 | AWAL | Claudin-5 | CLDN5 | CPETRL1 | TMDVCF | TMVCF | Claudin 5
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- O00501
- NCBI GenBank
- NM_003277, NP_003268.2
- SwissProt
- O00501
Target
- Target
- Human CLDN5 / Claudin 5
- Antigen Species
- Hu
- Gene Name
- CLDN5
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 230-303 of human CLDN5 (NP_001124333.1). REFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS