Western blot testing of human 1) HeLa, 2) MDA-MB-453, 3) Jurkat, 4) HepG2, 5) SK-OV-3, 6) PANC-1 and 7) mouse thymus lysate with CHRNA3 antibody at 0.5ug/ml. Predicted molecular weight ~57 kDa.

CHRNA3 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Flow Cytometry, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782130-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: CHRNA3 antibody LS-C782130 is an unconjugated rabbit polyclonal antibody to CHRNA3 from human. It is reactive with human, mouse and rat. Validated for Flow and WB.
Application: FC, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: AChR-alpha3 | Acra-3 | CHRNA3 | LNCR2 | NAChR alpha 3 | PAOD2 | NACHRA3
Recommended Dilution: FC: 1 - 3 µg/10E6 cells
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: P32297
NCBI GenBank: NM_000743 | NP_000734.2
SwissProt: P32297

Target

Target: Human CHRNA3
Antigen Species: Human
Gene Name: CHRNA3

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD from the human protein were used as the immunogen for the CHRNA3 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS