Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
CHRNA3 Antibody (DY488)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry |
| Reactivity: | Human |
| Format: | Liquid |
$583.00each
Catalog Number: LS-C756528-188
Catalog Number: LS-C756528
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CHRNA3 antibody LS-C756528 is a DY488-conjugated rabbit polyclonal antibody to human CHRNA3. Validated for Flow.
- Application
- FC
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AChR-alpha3 | Acra-3 | CHRNA3 | LNCR2 | NAChR alpha 3 | PAOD2 | NACHRA3
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- UniProt Number
- P32297
- NCBI GenBank
- NM_000743 | NP_000734.2
- SwissProt
- P32297
Target
- Target
- Human CHRNA3
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- CHRNA3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- DyLight 488
- Format
- Liquid
- Formulation
- 0.2% Na2HPO40.9% NaCl, 0.02% sodium azide, 50% glycerol
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. Do not freeze. Protect from light.
- Recommended Storage Buffer
- NaCl
