Western blot analysis of extracts of mouse brian.
CHRM3 / M3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C408330-20
Catalog Number: LS-C408330
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- M3 antibody LS-C408330 is an unconjugated rabbit polyclonal antibody to M3 (CHRM3) from human. It is reactive with mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CHRM3 | M3 | Muscarinic receptor M3 | Muscarinic M3 receptor | EGBRS | HM3 | M3 muscarinic receptor
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P20309
- NCBI GenBank
- NM_000740 | NP_000731.1
- SwissProt
- P20309
Target
- Target
- Human CHRM3 / M3
- Antigen Species
- Human
- Epitope
- Human CHRM3 / M3
- Gene Name
- CHRM3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 390-475 of human CHRM3 (NP_000731.1). QVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQI
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS