Immunohistochemistry of paraffin-embedded mouse brain using CHRM1 antibody at dilution of 1:100 (40x lens).
CHRM1 / M1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C747448-20
Catalog Number: LS-C747448
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- M1 antibody LS-C747448 is an unconjugated rabbit polyclonal antibody to M1 (CHRM1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Acetylcholine receptor M1 | M1R | M1 | M1 muscarinic receptor | CHRM1 | HM1 | Muscarinic M1 receptor
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P11229
- NCBI GenBank
- NM_000738 | NP_000729.2
- SwissProt
- P11229
Target
- Target
- Human CHRM1 / M1
- Antigen Species
- Human
- Gene Name
- CHRM1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 400 to the C-Terminus of human CHRM1 (NP_000729.2). WELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS