Western blot testing of human 1) HeLa, 2) U-87 MG, 3) A431, 4) K562, 5) A549, 6) Caco-2, 7) rat stomach and 8) mouse stomach lysate with CHM antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.
CHM / REP1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunofluorescence, Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782869-100
Catalog Number: LS-C782869
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- REP1 antibody LS-C782869 is an unconjugated rabbit polyclonal antibody to REP1 (CHM) from human. It is reactive with human, mouse and rat. Validated for Flow, IF, IHC and WB.
- Application
- FC, IF, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Choroideraemia protein | CHM | DXS540 | GGTA | HSD-32 | REP-1 | REP1 | Rab escort protein 1 | TCD | TCD protein
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- Recommended Dilution: IF/ICC
- 2 - 4 µg/ml
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P24386
- NCBI GenBank
- NM_000390 | NP_000381.1
- SwissProt
- P24386
Target
- Target
- Human CHM / REP1
- Antigen Species
- Human
- Gene Name
- CHM
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED from the human protein were used as the immunogen for the CHM antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS