Western blot testing of human 1) HeLa, 2) COLO-320, 3) SK-O-V3, 4) Jurkat, 5) rat heart and 6) mouse heart lysate with CEP68 antibody at 0.5ug/ml. Predicted molecular weight ~81 kDa (isoform 1), ~67 kDa (isoform 2).

CEP68 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782112-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: CEP68 antibody LS-C782112 is an unconjugated rabbit polyclonal antibody to CEP68 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CEP68 | KIAA0582 | Centrosomal protein 68kDa | Centrosomal protein of 68 kDa
Recommended Dilution: WB: 0.5 - 1 µg/ml
NCBI GenBank: NM_015147 | NP_055962.2

Target

Target: Human CEP68
Antigen Species: Human

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Amino acids ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID were used as the immunogen for the CEP68 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS