Western blot analysis of extracts of various cell lines, using CD59 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

CD59 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C747517-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: CD59 antibody LS-C747517 is an unconjugated rabbit polyclonal antibody to human CD59. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: 16.3A5 | 1F5 | 1F5 antigen | CD59 glycoprotein | EL32 | EJ16 | G344 | HRF-20 | MAC-IP | MACIF | Ly-6-like protein | MEM43 | MIRL | MEM43 antigen | MIN2 | MIN3 | MSK21 | p18-20 | Protectin | MAC-inhibitory protein | MIC11 | T cell-activating protein | CD59 | CD59 antigen | EJ30 | HRF20 | Human leukocyte antigen MIC11 | Lymphocytic antigen CD59/MEM43 | MIN1
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P13987
NCBI GenBank: NM_000611 | NP_000602.1
SwissProt: P13987

Target

Target: Human CD59
Antigen Species: Human
Gene Name: CD59

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 26-128 of human CD59 (NP_001120695.1). LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)