Western blot testing of human 1) MCF7, 2) SK-OV-3 and 3) PANC-1 cell lysate with CD47 antibody at 0.5ug/ml. Predicted molecular weight: 35~60 kDa depending on glycosylation level.

CD47 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782027-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: CD47 antibody LS-C782027 is an unconjugated rabbit polyclonal antibody to human CD47. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CD47 antigen | CD47 molecule | CD47 | Integrin associated protein | Integrin-associated protein | Leukocyte surface antigen CD47 | MER6 | Protein MER6 | Rh-related antigen | OA3 | CD47 glycoprotein | IAP
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q08722
NCBI GenBank: NM_001777 | NP_001768.1
SwissProt: Q08722

Target

Target: Human CD47
Antigen Species: Human
Gene Name: CD47

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT were used as the immunogen for the CD47 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS