
CD45 / LCA Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490459-100
Catalog Number: LS-C490459
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- LCA antibody LS-C490459 is an unconjugated rabbit polyclonal antibody to human LCA (CD45). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- B220 | CD45R | CD45 | gp180 | Leukocyte common antigen | L-CA | Leucocyte common antigen | LY5 | T200 | T200 glycoprotein | T200 leukocyte common antigen | CD45 antigen | LCA | PTPRC
- Recommended Dilution: IHC-P
- 0.5 - 1 µg/ml
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P08575
- NCBI GenBank
- NM_002838 | NP_002829.3
- SwissProt
- P08575
Target
- Target
- Human CD45 / LCA
- Antigen Species
- Human
- Gene Name
- PTPRC
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK of human CD45 were used as the immunogen for the CD45 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
