Western blot analysis of extract of various cells.

CD3D Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C331376-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: CD3D antibody LS-C331376 is an unconjugated rabbit polyclonal antibody to CD3D from human. It is reactive with human and rat. Validated for IHC and WB.
Application: IHC, WB
Reactivity: Hu, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CD3 delta | CD3d antigen | T-cell receptor T3 delta chain | T3D | CD3 antigen, delta subunit | CD3-DELTA | CD3D | OKT3, delta chain
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P04234
NCBI GenBank: NM_000732 | NP_000723.1
SwissProt: P04234

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-105 of human CD3D (NP_000723.1). FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)