Western blot - Anti-DC-SIGN Picoband antibody

CD209 / DC-SIGN Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Flow Cytometry, Immunocytochemistry, Immunohistochemistry (general), Immunohistochemistry, Frozen, Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C662685-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: DC-SIGN antibody LS-C662685 is an unconjugated rabbit polyclonal antibody to human DC-SIGN (CD209). Validated for Flow, ICC, IHC and WB.
Application: FC, ICC, IHC, IHC-F, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CD209 antigen | CD209 molecule | CDSIGN | CLEC4L | CD209 | DC-SIGN | HIV gpl20-binding protein | DC-SIGN1
UniProt Number: Q9NNX6
NCBI GenBank: NM_021155 | NP_066978.1
SwissProt: Q9NNX6

Target: Human CD209 / DC-SIGN
Antigen Species: Human
Epitope: Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes.
Gene Name: CD209

Immunogen: A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Preservative: Yes

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.