
Western blot analysis of extract of various cells.
CD200R1 / CD200R Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409814-20
Catalog Number: LS-C409814
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CD200R antibody LS-C409814 is an unconjugated rabbit polyclonal antibody to human CD200R (CD200R1). Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CD200R1 | CD200 receptor 1 | CD200R | MOX2R | OX2R | CRTR2 | MOX2 receptor
- UniProt Number
- Q8TD46
- NCBI GenBank
- NP_620161.1
- SwissProt
- Q8TD46
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human CD200R1 / CD200R
- Antigen Species
- Human
- Epitope
- Human CD200R1 / CD200R
- Gene Name
- CD200R1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 249-348 of human CD200R1 (NP_620161.1). SLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
