Western blot analysis of extracts of various cell lines.
CD144 / CDH5 / VE Cadherin Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C331090-20
Catalog Number: LS-C331090
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- VE Cadherin antibody LS-C331090 is an unconjugated rabbit polyclonal antibody to VE Cadherin (CD144 / CDH5) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 7B4 | 7B4 antigen | CD144 | CDH5 | Cadherin-5 | Endothelial-specific cadherin | Vascular endothelial cadherin | VE-cadherin | VEC | CD144 antigen | VE Cadherin
- Recommended Dilution: WB
- 1:500 - 1:1000
- UniProt Number
- P33151
- NCBI GenBank
- NM_001795 | NP_001786.2
- SwissProt
- P33151
Target
- Target
- Human CD144 / CDH5 / VE Cadherin
- Antigen Species
- Human
- Epitope
- Human CDH5 / VE Cadherin
- Gene Name
- CDH5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 259-358 of human CDH5 (NP_001786.2). TQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQ
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Concentration
- 0.62 mg/mL
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS