
Western blot testing of human 1) HepG2 and 2) SKOV3 cell lysate with IFNGR1 antibody at 0.5ug/ml. Predicted molecular weight: ~54 kDa (unmodified), 80-100 kDa (glycosylated).
CD119 / IFNGR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781959-100
Catalog Number: LS-C781959
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IFNGR1 antibody LS-C781959 is an unconjugated rabbit polyclonal antibody to human IFNGR1 (CD119). Validated for Flow and WB.
- Application
- FC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AVP, type 2 | Antiviral protein, type 2 | CD119 | CD119 antigen | IFNGR | IFN-gamma receptor 1 | IFN-gamma-R1 | IFNGR1 | Immune interferon receptor 1 | Interferon gamma receptor 1 | CDw119
- UniProt Number
- P15260
- NCBI GenBank
- NM_000416 | NP_000407.1
- SwissProt
- P15260
Recommended Dilution
| Application | Dilution |
|---|---|
| FC | 1 - 3 µg/10E6 cells |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human CD119 / IFNGR1
- Antigen Species
- Human
- Gene Name
- IFNGR1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 443-484 (QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED) from the human protein were used as the immunogen for the IFNGR1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
