Western blot testing of human HepG2 cell lysate with CD119 antibody at 0.5ug/ml. Predicted molecular weight: ~54 kDa (unmodified), 80-100 kDa (glycosylated).
CD119 / IFNGR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C781958-100
Catalog Number: LS-C781958
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IFNGR1 antibody LS-C781958 is an unconjugated rabbit polyclonal antibody to human IFNGR1 (CD119). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AVP, type 2 | Antiviral protein, type 2 | CD119 | CD119 antigen | IFNGR | IFN-gamma receptor 1 | IFN-gamma-R1 | IFNGR1 | Immune interferon receptor 1 | Interferon gamma receptor 1 | CDw119
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P15260
- NCBI GenBank
- NM_000416 | NP_000407.1
- SwissProt
- P15260
Target
- Target
- Human CD119 / IFNGR1
- Antigen Species
- Human
- Gene Name
- IFNGR1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 108-147 (QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH) from the human protein were used as the immunogen for the CD119 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS