Western blot - Anti-IFNGR1/Cd119 Picoband Antibody
CD119 / IFNGR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunocytochemistry, Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C661879-100
Catalog Number: LS-C661879
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IFNGR1 antibody LS-C661879 is an unconjugated rabbit polyclonal antibody to human IFNGR1 (CD119). Validated for Flow, ICC, IHC and WB.
- Application
- FC, ICC, IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- AVP, type 2 | Antiviral protein, type 2 | CD119 | CD119 antigen | IFNGR | IFN-gamma receptor 1 | IFN-gamma-R1 | IFNGR1 | Immune interferon receptor 1 | Interferon gamma receptor 1 | CDw119
- UniProt Number
- P15260
- NCBI GenBank
- NM_000416 | NP_000407.1
- SwissProt
- P15260
Target
- Target
- Human CD119 / IFNGR1
- Antigen Species
- Human
- Gene Name
- IFNGR1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human IFNGR1 (443-484 aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl