Western blot testing of 1) rat lung, 2) mouse lung and 3) human HeLa lysate with Endoglin antibody at 0.5ug/ml. Observed molecular weight: 70/90 kDa (monomer, unmodified/glycosylated); 140-180 kDa (dimer, unmodified/glycosylated).

CD105 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782782-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: CD105 antibody LS-C782782 is an unconjugated rabbit polyclonal antibody to CD105 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CD105 | CD105 antigen | ENG | END | HHT1 | ORW | ORW1 | Osler-Rendu-Weber syndrome 1 | Endoglin
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: P17813
NCBI GenBank: NM_000118 | NP_000109.1
SwissProt: P17813

Target

Target: Human CD105
Antigen Species: Human
Gene Name: ENG

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids 258-297 (YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ) from the human protein were used as the immunogen for the Endoglin antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS