Western blot testing of 1) rat brain, 2) rat spleen, 3) mouse brain, 4) mouse spleen and 5) human 293T lysate with CCS antibody at 0.5ug/ml. Predicted molecular weight ~34 kDa.

CCS Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782764-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: CCS antibody LS-C782764 is an unconjugated rabbit polyclonal antibody to CCS from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Application: IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CCS
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: O14618
NCBI GenBank: NM_005125 | NP_005116.1
SwissProt: O14618

Target

Target: Human CCS
Antigen Species: Human
Gene Name: CCS

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids 174-209 (DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR) from the human protein were used as the immunogen for the CCS antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS